PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen01g004640.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family EIL
Protein Properties Length: 614aa    MW: 69153.4 Da    PI: 5.1639
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen01g004640.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3514.35.5e-157504271353
                       XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
              EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLra 93 
                       +el+krmw+d+m+lkrlke++k     ke  ++a k+++s+eqarrkkmsraQDgiLkYMlk+mevc+aqGfvYgiipekgkpv+gasd+Lr+
  Sopen01g004640.1  50 DELEKRMWRDKMKLKRLKEMSKG----KEG-VDAVKQRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPEKGKPVTGASDNLRE 137
                       79*******************98....787.9************************************************************* PP

                       XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT- CS
              EIN3  94 WWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelgl 186
                       WWk+kv+fdrngpaai+kyqa+n+i++++++ +     ++h+l+elqDTtlgSLLsalmqhcdppqrrfplekgv+pPWWP+G+e+ww++lgl
  Sopen01g004640.1 138 WWKDKVRFDRNGPAAIAKYQADNAIPGKNEGANP-IGPTPHTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGVSPPWWPNGQEDWWPQLGL 229
                       ******************************9987.9********************************************************* PP

                       -TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX..XX.XXXXXXXXXXX CS
              EIN3 187 skdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsah..ss.slrkqspkvtl 276
                       s+dqg+ppykkphdlkkawkv+vLtavikh+sp+i++ir+l+rqsk+lqdkm+akes+++l+++nqee ++++++++  ++ sl  +s  +t+
  Sopen01g004640.1 230 SNDQGPPPYKKPHDLKKAWKVGVLTAVIKHISPDIAKIRKLVRQSKCLQDKMTAKESATWLAIINQEEVLARELYPDrcPPlSLGGGSGTFTM 322
                       *****************************************************************************863369999******* PP

                       XXXXXXXXXXXXXXX.XXXXXXXXXX..............................XXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XX CS
              EIN3 277 sceqkedvegkkeskikhvqavktta..............................gfpvvrkrkkkpsesakvsskevsrtcqssqfrgset 339
                       ++++++dveg  +  i +vq++k ++                              +++++rkrk + ++ +  ++   ++tc+  ++++se 
  Sopen01g004640.1 323 NDSSEYDVEGAIDDPIFDVQEQKPNHlsllnvnvemfkeklpllqqsqpmkgdifaNLDFTRKRK-PADDLTFLMDP-KTYTCECLHCPHSEL 413
                       ************************99**************************************9.55555554444.57************* PP

                       XXXXXXXXXXXXXX CS
              EIN3 340 elifadknsisqne 353
                       +++f+d++s+++++
  Sopen01g004640.1 414 RNGFPDRSSRDNHQ 427
                       ************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048732.0E-12950297No hitNo description
Gene3DG3DSA:1.10.3180.107.9E-75172307IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167683.01E-61176300IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001666Biological Processresponse to hypoxia
GO:0009873Biological Processethylene-activated signaling pathway
GO:0042742Biological Processdefense response to bacterium
GO:0071281Biological Processcellular response to iron ion
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 614 aa     Download sequence    Send to blast
MMMFEDIGFC GDLDFFPAPL KEAETVAAVP PIVPEPMMDD DDSDEEIDVD ELEKRMWRDK  60
MKLKRLKEMS KGKEGVDAVK QRQSQEQARR KKMSRAQDGI LKYMLKMMEV CKAQGFVYGI  120
IPEKGKPVTG ASDNLREWWK DKVRFDRNGP AAIAKYQADN AIPGKNEGAN PIGPTPHTLQ  180
ELQDTTLGSL LSALMQHCDP PQRRFPLEKG VSPPWWPNGQ EDWWPQLGLS NDQGPPPYKK  240
PHDLKKAWKV GVLTAVIKHI SPDIAKIRKL VRQSKCLQDK MTAKESATWL AIINQEEVLA  300
RELYPDRCPP LSLGGGSGTF TMNDSSEYDV EGAIDDPIFD VQEQKPNHLS LLNVNVEMFK  360
EKLPLLQQSQ PMKGDIFANL DFTRKRKPAD DLTFLMDPKT YTCECLHCPH SELRNGFPDR  420
SSRDNHQLTC LFRNTSQFVV PNFHMEEVKP VVFPQQYAEP KRASLPVNPA PPSFDTSGLG  480
VPADGQRVIN ELMSFYESNV QGNKSSMAGN SVMSKEQPLQ QPSIQQNNYL QSQGNVLEGS  540
IFGDTNISAN NSMFVQGDRF DQSKVLTSPF NASSTDDFNF MFGSPFNMQS NDLSECLSGI  600
SHDDMTKQDA SVWY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A6e-841753062133Protein ETHYLENE INSENSITIVE 3
4zds_B6e-841753062133Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00367DAPTransfer from AT3G20770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754400.0HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015060507.10.0PREDICTED: protein ETHYLENE INSENSITIVE 3
SwissprotO246060.0EIN3_ARATH; Protein ETHYLENE INSENSITIVE 3
TrEMBLQ94FV30.0Q94FV3_SOLLC; EIL2
STRINGSolyc01g009170.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA30423178
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20770.10.0EIL family protein